PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00048.42
Common NameAMTR_s00048p00089530, LOC18443813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 789aa    MW: 87787.8 Da    PI: 6.4363
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.42genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81.1e-1988143156
                                              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                 Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                              r++ ++++  q++e+e+lF+++++p+ ++r +L++ lgL+ rqVk+WFqNrR+++k
  evm_27.model.AmTr_v1.0_scaffold00048.42  88 RKRYHRHSVRQIQEMEALFKECPHPDDKQRLKLSQDLGLKPRQVKFWFQNRRTQMK 143
                                              7888999**********************************************998 PP

2START159.32.9e-502965202206
                                              HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHH CS
                                    START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlal 60 
                                              la +a++el+k+ +++e +W +s     e++n de+ ++f+   +        ++e  r ++ v+m++ +
  evm_27.model.AmTr_v1.0_scaffold00048.42 296 LAMAAMAELLKMSQLNEGLWLQSGgegrEILNVDEYAKSFQWPINhkqelsgWRTEGTRSTVTVIMNSIT 365
                                              57799***********************************665558899999999*************** PP

                                              HHHHHCCCGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.T CS
                                    START  61 lveellddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlg 119
                                              lv  +ld + +W e+++    ka t++vi+ g      g lqlm+ae+q+ +plvp R+++f+Ry++q  
  evm_27.model.AmTr_v1.0_scaffold00048.42 366 LVDAFLDAN-KWMEMFPsivsKARTVQVITAGlashgsGSLQLMYAEFQFFTPLVPtREVYFLRYCQQTA 434
                                              *********.************************************************************ PP

                                              TS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHH CS
                                    START 120 agdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksgl 189
                                              +g+wvivd  vd  +++  + ++ R +++pSg++i++++ng+s+vtwveh +++++ +h +++++v+sg 
  evm_27.model.AmTr_v1.0_scaffold00048.42 435 DGGWVIVDFPVDGISENL-QLPLSRYRRRPSGCVIKDMPNGYSRVTWVEHSEVDDKPIHPMFNQIVESGE 503
                                              ****************98.9************************************************** PP

                                              HHHHHHHHHHTXXXXXX CS
                                    START 190 aegaktwvatlqrqcek 206
                                              a+ga++w   lqrqce+
  evm_27.model.AmTr_v1.0_scaffold00048.42 504 AFGAQRWATVLQRQCER 520
                                              ***************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-2173143IPR009057Homeodomain-like
SuperFamilySSF466897.27E-1976146IPR009057Homeodomain-like
PROSITE profilePS5007116.87685145IPR001356Homeobox domain
SMARTSM003896.1E-1986149IPR001356Homeobox domain
CDDcd000866.28E-1887146No hitNo description
PfamPF000463.6E-1788143IPR001356Homeobox domain
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PROSITE profilePS5084844.843286523IPR002913START domain
SuperFamilySSF559619.42E-33289522No hitNo description
CDDcd088752.87E-111290519No hitNo description
SMARTSM002341.3E-30295520IPR002913START domain
PfamPF018522.8E-41296520IPR002913START domain
Gene3DG3DSA:3.30.530.209.1E-6372489IPR023393START-like domain
SuperFamilySSF559611.57E-17550779No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MYGDCQVMMS MGGNIVGEPM FPPSNLNFLH NLPYNSPPVF SSLLTKEDNG ALKGKEDELD  60
SKSGSGNIDG GVSEEHEDGE QQQRNPKRKR YHRHSVRQIQ EMEALFKECP HPDDKQRLKL  120
SQDLGLKPRQ VKFWFQNRRT QMKSQQDRAD NVILRAENEN LKNENVRLHG AIRNITCPAC  180
GGPAILGEMS LDEQHLRIEN ARLKEELERL NGMATRYAGG RPVHGMVQAP QMMVPSLDLD  240
IGMYTRQYHH EQAPPPPFCP PLCHTSDMMV PHSMPEINPL GTVGLLENDK PLAFDLAMAA  300
MAELLKMSQL NEGLWLQSGG EGREILNVDE YAKSFQWPIN HKQELSGWRT EGTRSTVTVI  360
MNSITLVDAF LDANKWMEMF PSIVSKARTV QVITAGLASH GSGSLQLMYA EFQFFTPLVP  420
TREVYFLRYC QQTADGGWVI VDFPVDGISE NLQLPLSRYR RRPSGCVIKD MPNGYSRVTW  480
VEHSEVDDKP IHPMFNQIVE SGEAFGAQRW ATVLQRQCER LASLMAENIS DRDLGVMTTL  540
EARRSLMRLA QRMMRIFCIN MSGSGGQSWT TLTGGPEDTV RITTRKNTEV GQPIGLILCA  600
ITTTWLPVPP HQVFDLLRDD RRRTELDVLS SGSASNEVAH IANGTHTGNC ISLYRVNTGG  660
NTPQNVELML QESCTDPSAS LVIYAPIDIS SVQMAVTSED HSYVPLLPSG FIITPRRQPN  720
DPKHAYNGNG ISSSNNRGDG CLMTVGVQML ASSNPTANLN FSAVPAINNH LCNAVNQIRA  780
ALLAPRDQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854056.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLU5D5B90.0U5D5B9_AMBTC; Uncharacterized protein
STRINGVIT_02s0012g02030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP94751113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]